It inverted font download

1 matching request on the forum Custom preview Fonts Size Sort by Only as  Public domain / GPL / OFL  100% Free  Free for personal use  Donationware  Shareware  Demo  Unknown Only fonts with  Accents  Euro Inversionz à € by Darrell Flood Download Donate to author Inversionz.otf Inversionz Italic.otf Inversionz Unboxed.otf Inversionz Unboxed Italic.otf Note of the author This revised update include now includes all Euro characters, has improved diagonal widths, Capture Restart and autonaming for long logging;.
LD Letterpress Inverted Font File Format: True Type Font (.ttf) Copyright: Copyright 2003 Inspire Graphics, Inc. All rights reserved. Style: Regular Version:  LD Letterpress Inverted Font Preview Download LD Letterpress Inverted Font Free Font Download: LD Letterpress Inverted Truetype Font  Download Free LD Letterpress Inverted Font (234 KB) LD Letterpress Inverted Font Custom Preview Tool Enter some text in the box below, then click the preview button.( Cookies must be enabled in your browser.) Share LD Letterpress Inverted Free Font Short URL Permalink URL Standard HREF Link Code Download More Free Fonts 3 D Fonts | Arial Fonts | Bold Fonts | Brush Fonts | Bubble Fonts | Celtic Fonts | Christmas Fonts | Comic Fonts | Condensed Fonts | Dots Fonts | Easter Fonts | Gothic Fonts | Graffiti Fonts | Halloween Fonts | Handwriting Fonts | Italic Fonts | Narrow Fonts | Oblique Fonts | Outline Fonts | Pixel Fonts | Script Fonts | Serif Fonts | Shadow Fonts | St Patrick's Day Fonts | Stencil Fonts | Tattoo Fonts | Techno Fonts | Typewriter Fonts Recommended Font Picks Communications P03 Open Type Download Communications P03 Open Type Bodoni BE Regular Exp 1 Open Type Download Bodoni BE Regular Exp 1 Open Type.
General Serif · Sans- Serif · Italic · Letterbats · Initials · Small Caps Size Poster · Display · Headlines · Text · Small Text · Captions Weight Hairline · Thin · Light · Regular · Medium · Bold · Heavy · Black · Fat Width Monospaced · Ultra Narrow · Extra Narrow · Narrow · Wide · Extra Wide · Ultra Wide Occasion Weddings · Baby Showers · Birthdays · Parties · Tattoos Holidays Christmas · Hanukkah · Valentine's Day · St. Patrick's Day · Easter · Halloween · Decade1990's · 1980's · 1970's · 1960's · 1950's · 1940's · 1930's · 1920's · 1910's · 1900's · 1890's · Foreign Imitation African · Alien · Arabic · Asian · Greek · Mexican · Runic · Russian · Yesteryear Retro · Vintage · Typewriter · Art Deco · Antique · Art Nouveau · Medieval · Blackletter · Old English Modern Techno · Futuristic · Science- Fiction · Digital · LCD · Blocky · Geometric · Stenciled · Neon · Hard to Read Style3d · Chunky · Comic · Calligraphy · Cute · Decorative · Fancy · Distorted · Grungy · Eroded · Outlined · Contoured · Multi-linear · Filled · Pixel · Warped Mood Quirky · Girly · Scary · Romantic · Groovy · Funky · Hot · Cold Handwriting Cursive · Script · Feminine · Masculine · Formal · Informal · Messy · Neat · Scribbled · Brushed · Graffiti · Theme Famous · Brandname · Army · Wild West · Circus · TV · Movies · Music · Athletics · Varsity · Sports Dingbats Icons · Borders · Frames · Animals · People · Flowers · Hearts · Food · Special Free Fonts for Commercial Use · New & Fresh Fonts · Most Popular Fonts · Alphabetic Fonts · Largest Font Families · Trending Fonts Hello, you seem to have Java Script turned off. Please enable it to use the advanced features of this website. Fonts 1 - 10 of 105invertedxposterdisplaygrungeerodedblack & whiteransom noteblackheavysans serifbouncyregularstaggeredhard to readnarrow3dboldcut-outpixelroughdingbatletterbatmediummixed widthsvintagedigitalfatstampedwideserifcircledretrodrop.